PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa16g043040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family BBR-BPC
Protein Properties Length: 296aa    MW: 33039.7 Da    PI: 9.9135
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa16g043040.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind332.11.5e-10112951301
       GAGA_bind   1 mdddgsre..rnkg.yye................paaslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalve 76 
                     m++ g+++  r+k+ y +                ++++l   +++++ms++aerda+i+ern+a+s+kk+ava+rd+a++qrdkal+er+kal+e
  Csa16g043040.1   1 MENGGQYDngRFKPdYLKgaqsmwnmmpqhqikeQHNALV--MNKKIMSILAERDAAIHERNQAVSAKKEAVAARDEALQQRDKALSERDKALIE 93 
                     8889998888999967779999999998777754446666..99*************************************************** PP

       GAGA_bind  77 rdnkllalllvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkks 171
                     rdn+++al+++ensl++a       lsg k  d          +d++v+  e +kl ++p+++ ++e++ ++k+ kr++++k   + + k kk +
  Csa16g043040.1  94 RDNAYAALQHHENSLNFA-------LSGGKRGD----------GDDCVG-VEPHKLAVFPLSTIPPEVTSTTKVAKRKKESK---QGQVKMKKVG 167
                     *************96655.......47888877..........688999.88999***********9999988884433333...3344667778 PP

       GAGA_bind 172 ekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafk 266
                     e+ +++v++++  ++s+++++s+d++ln v++De+ +PvP+C+CtG+ rqCYkWGnGGWqS+CCttt+S yPLP+++++r++R++grKmS+++f+
  Csa16g043040.1 168 EDLNRRVAAPG--KKSRKDWDSLDVGLNLVTFDETIMPVPMCTCTGSARQCYKWGNGGWQSSCCTTTLSLYPLPQMPNKRHSRMGGRKMSGNVFS 260
                     8999*******..56******************************************************************************** PP

       GAGA_bind 267 klLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                     +lL++LaaeGydls+pvDLkd+WA+HGtn+++ti+
  Csa16g043040.1 261 RLLSRLAAEGYDLSCPVDLKDYWARHGTNRYITIK 295
                     **********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012261.7E-1661295IPR010409GAGA-binding transcriptional activator
PfamPF062171.4E-9313295IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MENGGQYDNG RFKPDYLKGA QSMWNMMPQH QIKEQHNALV MNKKIMSILA ERDAAIHERN  60
QAVSAKKEAV AARDEALQQR DKALSERDKA LIERDNAYAA LQHHENSLNF ALSGGKRGDG  120
DDCVGVEPHK LAVFPLSTIP PEVTSTTKVA KRKKESKQGQ VKMKKVGEDL NRRVAAPGKK  180
SRKDWDSLDV GLNLVTFDET IMPVPMCTCT GSARQCYKWG NGGWQSSCCT TTLSLYPLPQ  240
MPNKRHSRMG GRKMSGNVFS RLLSRLAAEG YDLSCPVDLK DYWARHGTNR YITIK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2290900.0AK229090.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL16-37-J01.
GenBankAK3171650.0AK317165.1 Arabidopsis thaliana AT2G21240 mRNA, complete cds, clone: RAFL21-54-A06.
GenBankAY0845540.0AY084554.1 Arabidopsis thaliana clone 111536 mRNA, complete sequence.
GenBankBT0261090.0BT026109.1 Arabidopsis thaliana At2g21240 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010472104.10.0PREDICTED: protein BASIC PENTACYSTEINE4
SwissprotQ8S8C60.0BPC4_ARATH; Protein BASIC PENTACYSTEINE4
TrEMBLR0FWU30.0R0FWU3_9BRAS; Uncharacterized protein
TrEMBLR0HTS80.0R0HTS8_9BRAS; Uncharacterized protein (Fragment)
STRINGfgenesh2_kg.4__42__AT2G21240.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40902659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21240.20.0basic pentacysteine 4